![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.6: PLP-binding barrel [51419] (2 families) ![]() circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand |
![]() | Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins) |
![]() | Protein D-serine dehydratase [310801] (2 species) |
![]() | Species Idiomarina loihiensis [TaxId:283942] [311065] (1 PDB entry) |
![]() | Domain d3llxa2: 3llx A:19-256 [305820] Other proteins in same PDB: d3llxa1 complexed with cl, edo, trs, zn |
PDB Entry: 3llx (more details), 1.5 Å
SCOPe Domain Sequences for d3llxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3llxa2 c.1.6.1 (A:19-256) D-serine dehydratase {Idiomarina loihiensis [TaxId: 283942]} deaklksninylkqrveslgshlrphlktlrtleaagylldsksapatvstlaeaeayak agytdllyavgiapaklkrvaalrqqginlhilldnitqaqavvdyaaefgqdfsvfiei dsddhrggikpsdsklltiaktlgehftglmthaggsyacnteqglknfakqecdavria rnnletagihcaitsvgstptahfgedfsdisevragvyttfdlvmknigvcdfshia
Timeline for d3llxa2: