Lineage for d1ojt_2 (1ojt 276-400)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67238Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 67246Protein Dihydrolipoamide dehydrogenase [51959] (7 species)
  7. 67271Species Neisseria meningitidis [TaxId:487] [51964] (2 PDB entries)
  8. 67273Domain d1ojt_2: 1ojt 276-400 [30582]
    Other proteins in same PDB: d1ojt_3

Details for d1ojt_2

PDB Entry: 1ojt (more details), 2.7 Å

PDB Description: structure of dihydrolipoamide dehydrogenase

SCOP Domain Sequences for d1ojt_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojt_2 c.3.1.5 (276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis}
vtklpfipedpriidssgalalkevpgklliigggiiglemgtvystlgsrldvvemmdg
lmqgadrdlvkvwqkqneyrfdnimvntktvavepkedgvyvtfeganapkepqrydavl
vaagr

SCOP Domain Coordinates for d1ojt_2:

Click to download the PDB-style file with coordinates for d1ojt_2.
(The format of our PDB-style files is described here.)

Timeline for d1ojt_2: