Class b: All beta proteins [48724] (177 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) the barrel is decorated with additional structures |
Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 proteins) |
Protein D-serine dehydratase [310800] (2 species) Pfam PF14031 |
Species Idiomarina loihiensis [TaxId:283942] [311063] (1 PDB entry) |
Domain d3llxa1: 3llx A:3-18,A:257-375 [305819] Other proteins in same PDB: d3llxa2 complexed with cl, edo, trs, zn |
PDB Entry: 3llx (more details), 1.5 Å
SCOPe Domain Sequences for d3llxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3llxa1 b.49.2.2 (A:3-18,A:257-375) D-serine dehydratase {Idiomarina loihiensis [TaxId: 283942]} sapdwiahpdtpylliXmsvvttvighnkeknwlltdsgwmalsrdsgtagqnrdfgygq vckidgsvldglcvnstsqehgvielsdayqledfpvghqlrimpnhacataamhpvyhv lmsdgshntwqritgw
Timeline for d3llxa1: