Lineage for d3llxa1 (3llx A:3-18,A:257-375)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067173Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 2067498Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 2067499Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 proteins)
  6. 2067526Protein D-serine dehydratase [310800] (2 species)
    Pfam PF14031
  7. 2067532Species Idiomarina loihiensis [TaxId:283942] [311063] (1 PDB entry)
  8. 2067533Domain d3llxa1: 3llx A:3-18,A:257-375 [305819]
    Other proteins in same PDB: d3llxa2
    complexed with cl, edo, trs, zn

Details for d3llxa1

PDB Entry: 3llx (more details), 1.5 Å

PDB Description: crystal structure of an ala racemase-like protein (il1761) from idiomarina loihiensis at 1.50 a resolution
PDB Compounds: (A:) Predicted amino acid aldolase or racemase

SCOPe Domain Sequences for d3llxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3llxa1 b.49.2.2 (A:3-18,A:257-375) D-serine dehydratase {Idiomarina loihiensis [TaxId: 283942]}
sapdwiahpdtpylliXmsvvttvighnkeknwlltdsgwmalsrdsgtagqnrdfgygq
vckidgsvldglcvnstsqehgvielsdayqledfpvghqlrimpnhacataamhpvyhv
lmsdgshntwqritgw

SCOPe Domain Coordinates for d3llxa1:

Click to download the PDB-style file with coordinates for d3llxa1.
(The format of our PDB-style files is described here.)

Timeline for d3llxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3llxa2