SCOPe 2.07: Domain d3llxa1: 3llx A:3-18,A:257-375

Lineage for d3llxa1 (3llx A:3-18,A:257-375)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 protein domains)

6. Protein D-serine dehydratase [310800] (2 species)
   Pfam PF14031

7. Species Idiomarina loihiensis [TaxId:283942] [311063] (1 PDB entry)

8. Domain d3llxa1: 3llx A:3-18,A:257-375 [305819]
   Other proteins in same PDB: d3llxa2
   complexed with cl, edo, trs, zn

Details for d3llxa1

PDB Entry: 3llx, 1.5 Å

PDB Description: crystal structure of an ala racemase-like protein (il1761) from idiomarina loihiensis at 1.50 a resolution

PDB Compounds: (A:) Predicted amino acid aldolase or racemase

SCOPe Domain Sequences for d3llxa1:

Sequence; same for both SEQRES and ATOM records:

>d3llxa1 b.49.2.2 (A:3-18,A:257-375) D-serine dehydratase {Idiomarina loihiensis [TaxId: 283942]}
sapdwiahpdtpylliXmsvvttvighnkeknwlltdsgwmalsrdsgtagqnrdfgygq
vckidgsvldglcvnstsqehgvielsdayqledfpvghqlrimpnhacataamhpvyhv
lmsdgshntwqritgw

Timeline for d3llxa1:

• d3llxa1 first appeared in SCOPe 2.06