Lineage for d3llja_ (3llj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929713Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2929724Protein Histidine triad nucleotide-binding protein (HINT) [54199] (2 species)
  7. 2929765Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [54200] (10 PDB entries)
  8. 2929766Domain d3llja_: 3llj A: [305818]
    automated match to d1rzya_
    complexed with adn, na

Details for d3llja_

PDB Entry: 3llj (more details), 1.1 Å

PDB Description: Re-investigated high resolution crystal structure of histidine triad nucleotide-binding protein 1 (Hint1) from rabbit complexed with adenosine
PDB Compounds: (A:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d3llja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3llja_ d.13.1.1 (A:) Histidine triad nucleotide-binding protein (HINT) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rpggdtifgkiirkeipakiifeddqclafhdispqapthflvipkkhisqisaaedade
sllghlmivgkkcaadlglkkgyrmvvnegsdggqsvyhvhlhvlggrqmnwppg

SCOPe Domain Coordinates for d3llja_:

Click to download the PDB-style file with coordinates for d3llja_.
(The format of our PDB-style files is described here.)

Timeline for d3llja_: