Lineage for d3lh7b_ (3lh7 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231921Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2231922Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2232176Family d.159.1.7: YfcE-like [111233] (5 proteins)
  6. 2232194Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species)
  7. 2232206Species Mouse (Mus musculus) [TaxId:10090] [143936] (5 PDB entries)
    Uniprot Q9QZ88 1-182
  8. 2232212Domain d3lh7b_: 3lh7 B: [305817]
    automated match to d1z2wa1
    complexed with mn

Details for d3lh7b_

PDB Entry: 3lh7 (more details), 2.2 Å

PDB Description: Crystal structure of mouse VPS29 complexed with Mn2+
PDB Compounds: (B:) Vacuolar protein sorting-associated protein 29

SCOPe Domain Sequences for d3lh7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lh7b_ d.159.1.7 (B:) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]}
mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
ks

SCOPe Domain Coordinates for d3lh7b_:

Click to download the PDB-style file with coordinates for d3lh7b_.
(The format of our PDB-style files is described here.)

Timeline for d3lh7b_: