![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.7: YfcE-like [111233] (5 proteins) |
![]() | Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [143936] (6 PDB entries) Uniprot Q9QZ88 1-182 |
![]() | Domain d3lh6b_: 3lh6 B: [305815] automated match to d2a22b_ complexed with zn |
PDB Entry: 3lh6 (more details), 3 Å
SCOPe Domain Sequences for d3lh6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lh6b_ d.159.1.7 (B:) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk ks
Timeline for d3lh6b_: