Lineage for d3laba_ (3lab A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836526Species Oleispira antarctica [TaxId:188908] [226283] (2 PDB entries)
  8. 2836527Domain d3laba_: 3lab A: [305802]
    automated match to d3vcra_
    complexed with cl, ipa, na, pyr

Details for d3laba_

PDB Entry: 3lab (more details), 1.84 Å

PDB Description: Crystal structure of a putative Kdpg (2-keto-3-deoxy-6-phosphogluconate) aldolase from Oleispira antarctica
PDB Compounds: (A:) putative Kdpg (2-keto-3-deoxy-6-phosphogluconate) aldolase

SCOPe Domain Sequences for d3laba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3laba_ c.1.10.0 (A:) automated matches {Oleispira antarctica [TaxId: 188908]}
mtqldtwlantkplipvividdlvhaipmakalvaggvhllevtlrteaglaaisaikka
vpeaivgagtvctaddfqkaidagaqfivspgltpeliekakqvkldgqwqgvflpgvat
asevmiaaqagitqlkcfpasaiggakllkawsgpfpdiqfcptggiskdnykeylglpn
vicaggswltesklliegdwnevtrraseivklsdi

SCOPe Domain Coordinates for d3laba_:

Click to download the PDB-style file with coordinates for d3laba_.
(The format of our PDB-style files is described here.)

Timeline for d3laba_: