SCOPe 2.06: Domain d3l99a_: 3l99 A:

Lineage for d3l99a_ (3l99 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (2 families)

5. Family a.103.1.1: Citrate synthase [48257] (2 proteins)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain
   automatically mapped to Pfam PF00285

6. Protein automated matches [190675] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [311311] (2 PDB entries)

8. Domain d3l99a_: 3l99 A: [305800]
   automated match to d1nxea_
   complexed with oaa, so4

Details for d3l99a_

PDB Entry: 3l99, 2.1 Å

PDB Description: structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. coli complexed with oxaloacetate

PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d3l99a_:

Sequence; same for both SEQRES and ATOM records:

>d3l99a_ a.103.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftsttsceskitfid
gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtrhtmiheqitrl
fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi
gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt
agssganpfaciaagiaslwgpahgganeaalkmleeigkkenipefvrrakdkndsfrl
mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn
vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf
ksdikr

Timeline for d3l99a_:

• d3l99a_ is new in SCOPe 2.06-stable
  
• d3l99a_ appears in SCOPe 2.07
  
• d3l99a_ appears in the current release, SCOPe 2.08