Lineage for d3l99a_ (3l99 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722943Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2722944Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2722945Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2723011Protein automated matches [190675] (10 species)
    not a true protein
  7. 2723021Species Escherichia coli [TaxId:562] [311311] (2 PDB entries)
  8. 2723022Domain d3l99a_: 3l99 A: [305800]
    automated match to d1nxea_
    complexed with oaa, so4

Details for d3l99a_

PDB Entry: 3l99 (more details), 2.1 Å

PDB Description: structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. coli complexed with oxaloacetate
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d3l99a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l99a_ a.103.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftsttsceskitfid
gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtrhtmiheqitrl
fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi
gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt
agssganpfaciaagiaslwgpahgganeaalkmleeigkkenipefvrrakdkndsfrl
mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn
vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf
ksdikr

SCOPe Domain Coordinates for d3l99a_:

Click to download the PDB-style file with coordinates for d3l99a_.
(The format of our PDB-style files is described here.)

Timeline for d3l99a_: