![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.103.1: Citrate synthase [48256] (2 families) ![]() |
![]() | Family a.103.1.1: Citrate synthase [48257] (2 proteins) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain automatically mapped to Pfam PF00285 |
![]() | Protein Citrate synthase [48258] (7 species) |
![]() | Species Escherichia coli [TaxId:562] [81862] (12 PDB entries) Uniprot P00891 |
![]() | Domain d3l96b_: 3l96 B: [305795] automated match to d1nxea_ complexed with so4 |
PDB Entry: 3l96 (more details), 1.9 Å
SCOPe Domain Sequences for d3l96b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l96b_ a.103.1.1 (B:) Citrate synthase {Escherichia coli [TaxId: 562]} adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftsttsceskitfid gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtrhtmiheqitrl fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt agssganpfaciaagiaslwgpahgganeaalkmleeigkkenipefvrrakdkndsfrl mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf ksdikr
Timeline for d3l96b_: