SCOPe 2.08: Domain d3l5yl4: 3l5y L:106-213

Lineage for d3l5yl4 (3l5y L:106-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3l5yl4: 3l5y L:106-213 [305792]
   Other proteins in same PDB: d3l5ya_, d3l5yh_, d3l5yl3
   automated match to d1dn0a2

Details for d3l5yl4

PDB Entry: 3l5y, 2.8 Å

PDB Description: Crystal structure of the complex between IL-13 and M1295 FAB

PDB Compounds: (L:) m1295 light chain

SCOPe Domain Sequences for d3l5yl4:

Sequence; same for both SEQRES and ATOM records:

>d3l5yl4 b.1.1.2 (L:106-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d3l5yl4:

• d3l5yl4 first appeared in SCOPe 2.06
  
• d3l5yl4 appears in SCOPe 2.07