Lineage for d3l5yl4 (3l5y L:106-213)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (765 PDB entries)
  8. 2353414Domain d3l5yl4: 3l5y L:106-213 [305792]
    Other proteins in same PDB: d3l5ya_, d3l5yl3
    automated match to d1dn0a2

Details for d3l5yl4

PDB Entry: 3l5y (more details), 2.8 Å

PDB Description: Crystal structure of the complex between IL-13 and M1295 FAB
PDB Compounds: (L:) m1295 light chain

SCOPe Domain Sequences for d3l5yl4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l5yl4 b.1.1.2 (L:106-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d3l5yl4:

Click to download the PDB-style file with coordinates for d3l5yl4.
(The format of our PDB-style files is described here.)

Timeline for d3l5yl4:

View in 3D
Domains from same chain:
(mouse over for more information)
d3l5yl3
View in 3D
Domains from other chains:
(mouse over for more information)
d3l5ya_