Lineage for d1ebdb1 (1ebd B:7-154,B:272-346)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 576286Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 576287Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 576622Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 576639Protein Dihydrolipoamide dehydrogenase [51959] (8 species)
  7. 576645Species Bacillus stearothermophilus [TaxId:1422] [51963] (1 PDB entry)
  8. 576648Domain d1ebdb1: 1ebd B:7-154,B:272-346 [30579]
    Other proteins in same PDB: d1ebda3, d1ebdb3, d1ebdc_

Details for d1ebdb1

PDB Entry: 1ebd (more details), 2.6 Å

PDB Description: dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase

SCOP Domain Sequences for d1ebdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebdb1 c.3.1.5 (B:7-154,B:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus}
aietetlvvgagpggyvaairaaqlgqkvtivekgnlggvclnvgcipskalisashrye
qakhseemgikaenvtidfakvqewkasvvkkltggvegllkgnkveivkgeayfvdant
vrvvngdsaqtytfknaiiatgsrpielXvgrrpntdelgleqigikmtnrglievdqqc
rtsvpnifaigdivpgpalahkasyegkvaaeaiaghpsavdyv

SCOP Domain Coordinates for d1ebdb1:

Click to download the PDB-style file with coordinates for d1ebdb1.
(The format of our PDB-style files is described here.)

Timeline for d1ebdb1: