Lineage for d3l4za4 (3l4z A:732-868)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089028Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 2089029Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) (S)
  5. 2089076Family b.150.1.0: automated matches [310671] (1 protein)
    not a true family
  6. 2089077Protein automated matches [310870] (1 species)
    not a true protein
  7. 2089078Species Human (Homo sapiens) [TaxId:9606] [311309] (8 PDB entries)
  8. 2089083Domain d3l4za4: 3l4z A:732-868 [305786]
    Other proteins in same PDB: d3l4za1, d3l4za2, d3l4za3, d3l4za5
    automated match to d2qlya4
    complexed with gol, nag, ssd

Details for d3l4za4

PDB Entry: 3l4z (more details), 2 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with salacinol
PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d3l4za4:

Sequence, based on SEQRES records: (download)

>d3l4za4 b.150.1.0 (A:732-868) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpsqtsptvtydsnlkva
iitdidlllgeaytvew

Sequence, based on observed residues (ATOM records): (download)

>d3l4za4 b.150.1.0 (A:732-868) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpstsptvtydsnlkvai
itdidlllgeaytvew

SCOPe Domain Coordinates for d3l4za4:

Click to download the PDB-style file with coordinates for d3l4za4.
(The format of our PDB-style files is described here.)

Timeline for d3l4za4: