SCOPe 2.08: Domain d3l4za4: 3l4z A:732-868

Lineage for d3l4za4 (3l4z A:732-868)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
   sandwich; 10 strands in two sheets

4. Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families)

5. Family b.150.1.0: automated matches [310671] (1 protein)
   not a true family

6. Protein automated matches [310870] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311309] (8 PDB entries)

8. Domain d3l4za4: 3l4z A:732-868 [305786]
   Other proteins in same PDB: d3l4za1, d3l4za2, d3l4za3, d3l4za5
   automated match to d2qlya4
   complexed with gol, nag, ssd

Details for d3l4za4

PDB Entry: 3l4z, 2 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with salacinol

PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d3l4za4:

Sequence, based on SEQRES records:

>d3l4za4 b.150.1.0 (A:732-868) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpsqtsptvtydsnlkva
iitdidlllgeaytvew

Sequence, based on observed residues (ATOM records):

>d3l4za4 b.150.1.0 (A:732-868) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpstsptvtydsnlkvai
itdidlllgeaytvew

Timeline for d3l4za4:

• d3l4za4 first appeared in SCOPe 2.06
  
• d3l4za4 appears in SCOPe 2.07