Lineage for d3l4za3 (3l4z A:650-731)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2420422Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2420423Protein automated matches [226835] (41 species)
    not a true protein
  7. 2420534Species Human (Homo sapiens) [TaxId:9606] [225771] (22 PDB entries)
  8. 2420556Domain d3l4za3: 3l4z A:650-731 [305785]
    Other proteins in same PDB: d3l4za1, d3l4za2, d3l4za4, d3l4za5
    automated match to d2qlya3
    complexed with gol, nag, ssd

Details for d3l4za3

PDB Entry: 3l4z (more details), 2 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with salacinol
PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d3l4za3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4za3 b.71.1.0 (A:650-731) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvarpllhefyednstwdvhqqflwgpgllitpvldegaekvmayvpdavwydyetgsqv
rwrkqkvemelpgdkiglhlrg

SCOPe Domain Coordinates for d3l4za3:

Click to download the PDB-style file with coordinates for d3l4za3.
(The format of our PDB-style files is described here.)

Timeline for d3l4za3: