Lineage for d3l4za2 (3l4z A:270-649)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832243Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (6 proteins)
    Pfam PF01055
  6. 2832309Protein automated matches [310869] (3 species)
    not a true protein
  7. 2832310Species Human (Homo sapiens) [TaxId:9606] [311308] (7 PDB entries)
  8. 2832316Domain d3l4za2: 3l4z A:270-649 [305784]
    Other proteins in same PDB: d3l4za1, d3l4za3, d3l4za4, d3l4za5
    automated match to d2qlya2
    complexed with gol, nag, ssd

Details for d3l4za2

PDB Entry: 3l4z (more details), 2 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with salacinol
PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d3l4za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4za2 c.1.8.13 (A:270-649) automated matches {Human (Homo sapiens) [TaxId: 9606]}
peqvvqeyleligrpalpsywalgfhlsryeygtldnmrevvernraaqlpydvqhadid
ymderrdftydsvdfkgfpefvnelhnngqklviivdpaisnnsssskpygpydrgsdmk
iwvnssdgvtpligevwpgqtvfpdytnpncavwwtkefelfhnqvefdgiwidmnevsn
fvdgsvsgcstnnlnnppftprildgylfcktlcmdavqhwgkqydihnlygysmavata
eaaktvfpnkrsfiltrstfagsgkfaahwlgdntatwddlrwsipgvlefnlfgipmvg
pdicgfaldtpeelcrrwmqlgafypfsrnhngqgykdqdpasfgadslllnssrhylni
rytllpylytlffrahsrgd

SCOPe Domain Coordinates for d3l4za2:

Click to download the PDB-style file with coordinates for d3l4za2.
(The format of our PDB-style files is described here.)

Timeline for d3l4za2: