SCOPe 2.08: Domain d3l4za2: 3l4z A:270-649

Lineage for d3l4za2 (3l4z A:270-649)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (6 proteins)
   Pfam PF01055

6. Protein automated matches [310869] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311308] (7 PDB entries)

8. Domain d3l4za2: 3l4z A:270-649 [305784]
   Other proteins in same PDB: d3l4za1, d3l4za3, d3l4za4, d3l4za5
   automated match to d2qlya2
   complexed with gol, nag, ssd

Details for d3l4za2

PDB Entry: 3l4z, 2 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with salacinol

PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d3l4za2:

Sequence; same for both SEQRES and ATOM records:

>d3l4za2 c.1.8.13 (A:270-649) automated matches {Human (Homo sapiens) [TaxId: 9606]}
peqvvqeyleligrpalpsywalgfhlsryeygtldnmrevvernraaqlpydvqhadid
ymderrdftydsvdfkgfpefvnelhnngqklviivdpaisnnsssskpygpydrgsdmk
iwvnssdgvtpligevwpgqtvfpdytnpncavwwtkefelfhnqvefdgiwidmnevsn
fvdgsvsgcstnnlnnppftprildgylfcktlcmdavqhwgkqydihnlygysmavata
eaaktvfpnkrsfiltrstfagsgkfaahwlgdntatwddlrwsipgvlefnlfgipmvg
pdicgfaldtpeelcrrwmqlgafypfsrnhngqgykdqdpasfgadslllnssrhylni
rytllpylytlffrahsrgd

Timeline for d3l4za2:

• d3l4za2 first appeared in SCOPe 2.06
  
• d3l4za2 appears in SCOPe 2.07