Lineage for d3l4za1 (3l4z A:7-269)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391750Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2391751Protein automated matches [226849] (8 species)
    not a true protein
  7. 2391859Species Human (Homo sapiens) [TaxId:9606] [311307] (8 PDB entries)
  8. 2391865Domain d3l4za1: 3l4z A:7-269 [305783]
    Other proteins in same PDB: d3l4za2, d3l4za3, d3l4za4, d3l4za5
    automated match to d2qlya1
    complexed with gol, nag, ssd

Details for d3l4za1

PDB Entry: 3l4z (more details), 2 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with salacinol
PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d3l4za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4za1 b.30.5.0 (A:7-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnelerincipdqpptkatcdqrgccwnpqgavsvpwcyysknhsyhvegnlvntnagft
arlknlpsspvfgsnvdnvlltaeyqtsnrfhfkltdqtnnrfevphehvqsfsgnaaas
ltyqveisrqpfsikvtrrsnnrvlfdssigpllfadqflqlstrlpstnvyglgehvhq
qyrhdmnwktwpifnrdttpngngtnlygaqtfflcledasglsfgvflmnsnamevvlq
papaityrtiggildfyvflgnt

SCOPe Domain Coordinates for d3l4za1:

Click to download the PDB-style file with coordinates for d3l4za1.
(The format of our PDB-style files is described here.)

Timeline for d3l4za1: