Lineage for d3l4ya4 (3l4y A:732-868)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433829Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 2433830Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) (S)
  5. 2433877Family b.150.1.0: automated matches [310671] (1 protein)
    not a true family
  6. 2433878Protein automated matches [310870] (1 species)
    not a true protein
  7. 2433879Species Human (Homo sapiens) [TaxId:9606] [311309] (8 PDB entries)
  8. 2433880Domain d3l4ya4: 3l4y A:732-868 [305781]
    Other proteins in same PDB: d3l4ya1, d3l4ya2, d3l4ya3, d3l4ya5
    automated match to d2qlya4
    complexed with gol, nag, nr4, so4

Details for d3l4ya4

PDB Entry: 3l4y (more details), 1.8 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with nr4-8ii
PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d3l4ya4:

Sequence, based on SEQRES records: (download)

>d3l4ya4 b.150.1.0 (A:732-868) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpsqtsptvtydsnlkva
iitdidlllgeaytvew

Sequence, based on observed residues (ATOM records): (download)

>d3l4ya4 b.150.1.0 (A:732-868) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpstsptvtydsnlkvai
itdidlllgeaytvew

SCOPe Domain Coordinates for d3l4ya4:

Click to download the PDB-style file with coordinates for d3l4ya4.
(The format of our PDB-style files is described here.)

Timeline for d3l4ya4: