Class b: All beta proteins [48724] (180 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
Protein automated matches [226849] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311307] (8 PDB entries) |
Domain d3l4ya1: 3l4y A:7-269 [305778] Other proteins in same PDB: d3l4ya2, d3l4ya3, d3l4ya4, d3l4ya5 automated match to d2qlya1 complexed with gol, nag, nr4, so4 |
PDB Entry: 3l4y (more details), 1.8 Å
SCOPe Domain Sequences for d3l4ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l4ya1 b.30.5.0 (A:7-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} vnelerincipdqpptkatcdqrgccwnpqgavsvpwcyysknhsyhvegnlvntnagft arlknlpsspvfgsnvdnvlltaeyqtsnrfhfkltdqtnnrfevphehvqsfsgnaaas ltyqveisrqpfsikvtrrsnnrvlfdssigpllfadqflqlstrlpstnvyglgehvhq qyrhdmnwktwpifnrdttpngngtnlygaqtfflcledasglsfgvflmnsnamevvlq papaityrtiggildfyvflgnt
Timeline for d3l4ya1:
View in 3D Domains from same chain: (mouse over for more information) d3l4ya2, d3l4ya3, d3l4ya4, d3l4ya5 |