![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily) sandwich; 10 strands in two sheets |
![]() | Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) ![]() |
![]() | Family b.150.1.0: automated matches [310671] (1 protein) not a true family |
![]() | Protein automated matches [310870] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [311309] (8 PDB entries) |
![]() | Domain d3l4xa4: 3l4x A:732-868 [305776] Other proteins in same PDB: d3l4xa1, d3l4xa2, d3l4xa3, d3l4xa5 automated match to d2qlya4 complexed with gol, nag, nr3 |
PDB Entry: 3l4x (more details), 1.9 Å
SCOPe Domain Sequences for d3l4xa4:
Sequence, based on SEQRES records: (download)
>d3l4xa4 b.150.1.0 (A:732-868) automated matches {Human (Homo sapiens) [TaxId: 9606]} gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpsqtsptvtydsnlkva iitdidlllgeaytvew
>d3l4xa4 b.150.1.0 (A:732-868) automated matches {Human (Homo sapiens) [TaxId: 9606]} gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpstsptvtydsnlkvai itdidlllgeaytvew
Timeline for d3l4xa4:
![]() Domains from same chain: (mouse over for more information) d3l4xa1, d3l4xa2, d3l4xa3, d3l4xa5 |