![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
![]() | Protein automated matches [226849] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [311307] (8 PDB entries) |
![]() | Domain d3l4xa1: 3l4x A:7-269 [305773] Other proteins in same PDB: d3l4xa2, d3l4xa3, d3l4xa4, d3l4xa5 automated match to d2qlya1 complexed with gol, nag, nr3 |
PDB Entry: 3l4x (more details), 1.9 Å
SCOPe Domain Sequences for d3l4xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l4xa1 b.30.5.0 (A:7-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} vnelerincipdqpptkatcdqrgccwnpqgavsvpwcyysknhsyhvegnlvntnagft arlknlpsspvfgsnvdnvlltaeyqtsnrfhfkltdqtnnrfevphehvqsfsgnaaas ltyqveisrqpfsikvtrrsnnrvlfdssigpllfadqflqlstrlpstnvyglgehvhq qyrhdmnwktwpifnrdttpngngtnlygaqtfflcledasglsfgvflmnsnamevvlq papaityrtiggildfyvflgnt
Timeline for d3l4xa1:
![]() Domains from same chain: (mouse over for more information) d3l4xa2, d3l4xa3, d3l4xa4, d3l4xa5 |