![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
![]() | Protein automated matches [226835] (41 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225771] (22 PDB entries) |
![]() | Domain d3l4wa3: 3l4w A:650-731 [305770] Other proteins in same PDB: d3l4wa1, d3l4wa2, d3l4wa4, d3l4wa5 automated match to d2qlya3 complexed with gol, mig, nag |
PDB Entry: 3l4w (more details), 2 Å
SCOPe Domain Sequences for d3l4wa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l4wa3 b.71.1.0 (A:650-731) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvarpllhefyednstwdvhqqflwgpgllitpvldegaekvmayvpdavwydyetgsqv rwrkqkvemelpgdkiglhlrg
Timeline for d3l4wa3:
![]() Domains from same chain: (mouse over for more information) d3l4wa1, d3l4wa2, d3l4wa4, d3l4wa5 |