Lineage for d1ebda1 (1ebd A:7-154,A:272-346)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67238Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 67246Protein Dihydrolipoamide dehydrogenase [51959] (7 species)
  7. 67252Species Bacillus stearothermophilus [TaxId:1422] [51963] (1 PDB entry)
  8. 67253Domain d1ebda1: 1ebd A:7-154,A:272-346 [30577]
    Other proteins in same PDB: d1ebda3, d1ebdb3, d1ebdc_

Details for d1ebda1

PDB Entry: 1ebd (more details), 2.6 Å

PDB Description: dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase

SCOP Domain Sequences for d1ebda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus}
aietetlvvgagpggyvaairaaqlgqkvtivekgnlggvclnvgcipskalisashrye
qakhseemgikaenvtidfakvqewkasvvkkltggvegllkgnkveivkgeayfvdant
vrvvngdsaqtytfknaiiatgsrpielXvgrrpntdelgleqigikmtnrglievdqqc
rtsvpnifaigdivpgpalahkasyegkvaaeaiaghpsavdyv

SCOP Domain Coordinates for d1ebda1:

Click to download the PDB-style file with coordinates for d1ebda1.
(The format of our PDB-style files is described here.)

Timeline for d1ebda1: