Lineage for d1ebda1 (1ebd A:7-154,A:272-346)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2849925Protein Dihydrolipoamide dehydrogenase, N- and C-terminal domain [418938] (8 species)
  7. 2849929Species Bacillus stearothermophilus [TaxId:1422] [419380] (1 PDB entry)
  8. 2849930Domain d1ebda1: 1ebd A:7-154,A:272-346 [30577]
    Other proteins in same PDB: d1ebda2, d1ebda3, d1ebdb2, d1ebdb3, d1ebdc_
    complexed with fad
    has additional insertions and/or extensions that are not grouped together

Details for d1ebda1

PDB Entry: 1ebd (more details), 2.6 Å

PDB Description: dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase
PDB Compounds: (A:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1ebda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase, N- and C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
aietetlvvgagpggyvaairaaqlgqkvtivekgnlggvclnvgcipskalisashrye
qakhseemgikaenvtidfakvqewkasvvkkltggvegllkgnkveivkgeayfvdant
vrvvngdsaqtytfknaiiatgsrpielXvgrrpntdelgleqigikmtnrglievdqqc
rtsvpnifaigdivpgpalahkasyegkvaaeaiaghpsavdyv

SCOPe Domain Coordinates for d1ebda1:

Click to download the PDB-style file with coordinates for d1ebda1.
(The format of our PDB-style files is described here.)

Timeline for d1ebda1: