Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein Dihydrolipoamide dehydrogenase, N- and C-terminal domain [418938] (8 species) |
Species Bacillus stearothermophilus [TaxId:1422] [419380] (1 PDB entry) |
Domain d1ebda1: 1ebd A:7-154,A:272-346 [30577] Other proteins in same PDB: d1ebda2, d1ebda3, d1ebdb2, d1ebdb3, d1ebdc_ complexed with fad has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ebd (more details), 2.6 Å
SCOPe Domain Sequences for d1ebda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase, N- and C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} aietetlvvgagpggyvaairaaqlgqkvtivekgnlggvclnvgcipskalisashrye qakhseemgikaenvtidfakvqewkasvvkkltggvegllkgnkveivkgeayfvdant vrvvngdsaqtytfknaiiatgsrpielXvgrrpntdelgleqigikmtnrglievdqqc rtsvpnifaigdivpgpalahkasyegkvaaeaiaghpsavdyv
Timeline for d1ebda1:
View in 3D Domains from other chains: (mouse over for more information) d1ebdb1, d1ebdb2, d1ebdb3, d1ebdc_ |