Lineage for d3l4wa2 (3l4w A:270-649)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095223Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (5 proteins)
    Pfam PF01055
  6. 2095272Protein automated matches [310869] (2 species)
    not a true protein
  7. 2095273Species Human (Homo sapiens) [TaxId:9606] [311308] (7 PDB entries)
  8. 2095277Domain d3l4wa2: 3l4w A:270-649 [305769]
    Other proteins in same PDB: d3l4wa1, d3l4wa3, d3l4wa4, d3l4wa5
    automated match to d2qlya2
    complexed with gol, mig, nag

Details for d3l4wa2

PDB Entry: 3l4w (more details), 2 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with miglitol
PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d3l4wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4wa2 c.1.8.13 (A:270-649) automated matches {Human (Homo sapiens) [TaxId: 9606]}
peqvvqeyleligrpalpsywalgfhlsryeygtldnmrevvernraaqlpydvqhadid
ymderrdftydsvdfkgfpefvnelhnngqklviivdpaisnnsssskpygpydrgsdmk
iwvnssdgvtpligevwpgqtvfpdytnpncavwwtkefelfhnqvefdgiwidmnevsn
fvdgsvsgcstnnlnnppftprildgylfcktlcmdavqhwgkqydihnlygysmavata
eaaktvfpnkrsfiltrstfagsgkfaahwlgdntatwddlrwsipgvlefnlfgipmvg
pdicgfaldtpeelcrrwmqlgafypfsrnhngqgykdqdpasfgadslllnssrhylni
rytllpylytlffrahsrgd

SCOPe Domain Coordinates for d3l4wa2:

Click to download the PDB-style file with coordinates for d3l4wa2.
(The format of our PDB-style files is described here.)

Timeline for d3l4wa2: