Lineage for d3l4va2 (3l4v A:270-649)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440921Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (5 proteins)
    Pfam PF01055
  6. 2440970Protein automated matches [310869] (3 species)
    not a true protein
  7. 2440971Species Human (Homo sapiens) [TaxId:9606] [311308] (7 PDB entries)
  8. 2440978Domain d3l4va2: 3l4v A:270-649 [305764]
    Other proteins in same PDB: d3l4va1, d3l4va3, d3l4va4, d3l4va5
    automated match to d2qlya2
    complexed with ktl, nag

Details for d3l4va2

PDB Entry: 3l4v (more details), 2.1 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with kotalanol
PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d3l4va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4va2 c.1.8.13 (A:270-649) automated matches {Human (Homo sapiens) [TaxId: 9606]}
peqvvqeyleligrpalpsywalgfhlsryeygtldnmrevvernraaqlpydvqhadid
ymderrdftydsvdfkgfpefvnelhnngqklviivdpaisnnsssskpygpydrgsdmk
iwvnssdgvtpligevwpgqtvfpdytnpncavwwtkefelfhnqvefdgiwidmnevsn
fvdgsvsgcstnnlnnppftprildgylfcktlcmdavqhwgkqydihnlygysmavata
eaaktvfpnkrsfiltrstfagsgkfaahwlgdntatwddlrwsipgvlefnlfgipmvg
pdicgfaldtpeelcrrwmqlgafypfsrnhngqgykdqdpasfgadslllnssrhylni
rytllpylytlffrahsrgd

SCOPe Domain Coordinates for d3l4va2:

Click to download the PDB-style file with coordinates for d3l4va2.
(The format of our PDB-style files is described here.)

Timeline for d3l4va2: