SCOPe 2.06: Domain d3l4va1: 3l4v A:7-269

Lineage for d3l4va1 (3l4v A:7-269)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.0: automated matches [227145] (1 protein)
   not a true family

6. Protein automated matches [226849] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311307] (8 PDB entries)

8. Domain d3l4va1: 3l4v A:7-269 [305763]
   Other proteins in same PDB: d3l4va2, d3l4va3, d3l4va4, d3l4va5
   automated match to d2qlya1
   complexed with ktl, nag

Details for d3l4va1

PDB Entry: 3l4v, 2.1 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with kotalanol

PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d3l4va1:

Sequence; same for both SEQRES and ATOM records:

>d3l4va1 b.30.5.0 (A:7-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnelerincipdqpptkatcdqrgccwnpqgavsvpwcyysknhsyhvegnlvntnagft
arlknlpsspvfgsnvdnvlltaeyqtsnrfhfkltdqtnnrfevphehvqsfsgnaaas
ltyqveisrqpfsikvtrrsnnrvlfdssigpllfadqflqlstrlpstnvyglgehvhq
qyrhdmnwktwpifnrdttpngngtnlygaqtfflcledasglsfgvflmnsnamevvlq
papaityrtiggildfyvflgnt

Timeline for d3l4va1:

• d3l4va1 is new in SCOPe 2.06-stable
  
• d3l4va1 appears in SCOPe 2.07
  
• d3l4va1 appears in the current release, SCOPe 2.08