Class b: All beta proteins [48724] (178 folds) |
Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily) sandwich; 10 strands in two sheets |
Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) |
Family b.150.1.0: automated matches [310671] (1 protein) not a true family |
Protein automated matches [310870] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311309] (8 PDB entries) |
Domain d3l4ua4: 3l4u A:732-868 [305761] Other proteins in same PDB: d3l4ua1, d3l4ua2, d3l4ua3, d3l4ua5 automated match to d2qlya4 complexed with dsk, nag, so4 |
PDB Entry: 3l4u (more details), 1.9 Å
SCOPe Domain Sequences for d3l4ua4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l4ua4 b.150.1.0 (A:732-868) automated matches {Human (Homo sapiens) [TaxId: 9606]} gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpsqtsptvtydsnlkva iitdidlllgeaytvew
Timeline for d3l4ua4:
View in 3D Domains from same chain: (mouse over for more information) d3l4ua1, d3l4ua2, d3l4ua3, d3l4ua5 |