Lineage for d3l4ua4 (3l4u A:732-868)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825025Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 2825026Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) (S)
  5. 2825090Family b.150.1.0: automated matches [310671] (1 protein)
    not a true family
  6. 2825091Protein automated matches [310870] (1 species)
    not a true protein
  7. 2825092Species Human (Homo sapiens) [TaxId:9606] [311309] (8 PDB entries)
  8. 2825095Domain d3l4ua4: 3l4u A:732-868 [305761]
    Other proteins in same PDB: d3l4ua1, d3l4ua2, d3l4ua3, d3l4ua5
    automated match to d2qlya4
    complexed with dsk, nag, so4

Details for d3l4ua4

PDB Entry: 3l4u (more details), 1.9 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with de-o- sulfonated kotalanol
PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d3l4ua4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4ua4 b.150.1.0 (A:732-868) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpsqtsptvtydsnlkva
iitdidlllgeaytvew

SCOPe Domain Coordinates for d3l4ua4:

Click to download the PDB-style file with coordinates for d3l4ua4.
(The format of our PDB-style files is described here.)

Timeline for d3l4ua4: