SCOPe 2.07: Domain d3l4ta2: 3l4t A:270-649

Lineage for d3l4ta2 (3l4t A:270-649)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (5 proteins)
   Pfam PF01055

6. Protein automated matches [310869] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311308] (7 PDB entries)

8. Domain d3l4ta2: 3l4t A:270-649 [305754]
   Other proteins in same PDB: d3l4ta1, d3l4ta3, d3l4ta4, d3l4ta5
   automated match to d2qlya2
   complexed with bj1, nag

Details for d3l4ta2

PDB Entry: 3l4t, 1.9 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with bj2661

PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d3l4ta2:

Sequence; same for both SEQRES and ATOM records:

>d3l4ta2 c.1.8.13 (A:270-649) automated matches {Human (Homo sapiens) [TaxId: 9606]}
peqvvqeyleligrpalpsywalgfhlsryeygtldnmrevvernraaqlpydvqhadid
ymderrdftydsvdfkgfpefvnelhnngqklviivdpaisnnsssskpygpydrgsdmk
iwvnssdgvtpligevwpgqtvfpdytnpncavwwtkefelfhnqvefdgiwidmnevsn
fvdgsvsgcstnnlnnppftprildgylfcktlcmdavqhwgkqydihnlygysmavata
eaaktvfpnkrsfiltrstfagsgkfaahwlgdntatwddlrwsipgvlefnlfgipmvg
pdicgfaldtpeelcrrwmqlgafypfsrnhngqgykdqdpasfgadslllnssrhylni
rytllpylytlffrahsrgd

Timeline for d3l4ta2:

• d3l4ta2 first appeared in SCOPe 2.06
  
• d3l4ta2 appears in the current release, SCOPe 2.08