Lineage for d3kvcb_ (3kvc B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066532Superfamily b.69.15: Retinal pigment epithelial membrane protein-like [310595] (1 family) (S)
    Pfam PF03055
  5. 2066533Family b.69.15.1: RPE65-like [310643] (2 protein domains)
  6. 2066534Protein RPE65 [310786] (2 species)
  7. 2066535Species Cow (Bos taurus) [TaxId:9913] [311043] (8 PDB entries)
  8. 2066537Domain d3kvcb_: 3kvc B: [305741]
    automated match to d3fsna_
    complexed with fe2

Details for d3kvcb_

PDB Entry: 3kvc (more details), 1.9 Å

PDB Description: crystal structure of bovine rpe65 at 1.9 angstrom resolution
PDB Compounds: (B:) Retinoid isomerohydrolase

SCOPe Domain Sequences for d3kvcb_:

Sequence, based on SEQRES records: (download)

>d3kvcb_ b.69.15.1 (B:) RPE65 {Cow (Bos taurus) [TaxId: 9913]}
sqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhlfd
gqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpdpcknifsrffsy
frgvevtdnalvniypvgedyyactetnfitkvnpetletikqvdlcnyvsvngatahph
iendgtvynigncfgknfsiaynivkipplqadkedpiskseivvqfpcsdrfkpsyvhs
fgltpnyivfvetpvkinlfkflsswslwganymdcfesnetmgvwlhiadkkrkkyinn
kyrtspfnlfhhintyedheflivdlccwkgfefvynylylanlrenweevkknarkapq
pevrryvlplnidkadtgknlvtlpnttatailcsdetiwlepevlfsgprqafefpqin
yqkyggkpytyayglglnhfvpdrlcklnvktketwvwqepdsypsepifvshpdaleed
dgvvlsvvvspgagqkpayllilnakdlsevaraeveinipvtfhglfkks

Sequence, based on observed residues (ATOM records): (download)

>d3kvcb_ b.69.15.1 (B:) RPE65 {Cow (Bos taurus) [TaxId: 9913]}
sqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhlfd
gqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcaevtdnalvniypvge
dyyactetnfitkvnpetletikqvdlcnyvsvngatahphiendgtvynigncfgsiay
nivkipplqadkedpiskseivvqfpcsdrfkpsyvhsfgltpnyivfvetpvkinanym
dcfesnetmgvwlhiadkkrkkyinnkyrtspfnlfhhintyedheflivdlccwkgfef
vynylylanlrenweevkknarkapqpevrryvlplnidkadtgknlvtlpnttatailc
sdetiwlepevlfsgprqafefpqinyqkyggkpytyayglglnhfvpdrlcklnvktke
twvwqepdsypsepifvshpdaleeddgvvlsvvvspgagqkpayllilnakdlsevara
eveinipvtfhglfkks

SCOPe Domain Coordinates for d3kvcb_:

Click to download the PDB-style file with coordinates for d3kvcb_.
(The format of our PDB-style files is described here.)

Timeline for d3kvcb_:

  • d3kvcb_ is new in SCOPe 2.06-stable