Lineage for d3lada2 (3lad A:159-277)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67238Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 67246Protein Dihydrolipoamide dehydrogenase [51959] (7 species)
  7. 67247Species Azotobacter vinelandii [TaxId:354] [51962] (1 PDB entry)
  8. 67249Domain d3lada2: 3lad A:159-277 [30574]
    Other proteins in same PDB: d3lada3, d3ladb3

Details for d3lada2

PDB Entry: 3lad (more details), 2.2 Å

PDB Description: refined crystal structure of lipoamide dehydrogenase from azotobacter vinelandii at 2.2 angstroms resolution. a comparison with the structure of glutathione reductase

SCOP Domain Sequences for d3lada2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii}
papvdqdvivdstgaldfqnvpgklgvigagviglelgsvwarlgaevtvleamdkflpa
vdeqvakeaqkiltkqglkillgarvtgtevknkqvtvkfvdaegeksqafdklivavg

SCOP Domain Coordinates for d3lada2:

Click to download the PDB-style file with coordinates for d3lada2.
(The format of our PDB-style files is described here.)

Timeline for d3lada2: