SCOPe 2.06: Domain d3kuad_: 3kua D:

Lineage for d3kuad_ (3kua D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.1: CcdB [50119] (1 protein)
   automatically mapped to Pfam PF01845

6. Protein CcdB [50120] (2 species)
   topoisomerase poison

7. Species Vibrio fischeri [TaxId:668] [189154] (7 PDB entries)

8. Domain d3kuad_: 3kua D: [305737]
   Other proteins in same PDB: d3kuaa1, d3kuaa2, d3kuab1, d3kuab2
   automated match to d4elzc_
   complexed with gol

Details for d3kuad_

PDB Entry: 3kua, 2.13 Å

PDB Description: CcdBVfi:GyrA14Vfi

PDB Compounds: (D:) ccdb

SCOPe Domain Sequences for d3kuad_:

Sequence, based on SEQRES records:

>d3kuad_ b.34.6.1 (D:) CcdB {Vibrio fischeri [TaxId: 668]}
sqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpielldkkapshlcptihid
egdfimltqqmtsvpvkilsepvnelstfrneiiaaidflitg

Sequence, based on observed residues (ATOM records):

>d3kuad_ b.34.6.1 (D:) CcdB {Vibrio fischeri [TaxId: 668]}
sqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpiellkapshlcptihideg
dfimltqqmtsvpvkilsepvnelstfrneiiaaidflitg

Timeline for d3kuad_:

• d3kuad_ is new in SCOPe 2.06-stable
  
• d3kuad_ appears in SCOPe 2.07
  
• d3kuad_ appears in the current release, SCOPe 2.08