Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.11: Type II DNA topoisomerase C-terminal domain-like [56718] (1 superfamily) 4 domains: (1) toprim alpha/beta; (2) "winged helix"-like; (3) alpha+beta; (4) all-alpha |
Superfamily e.11.1: Type II DNA topoisomerase C-terminal domain-like [56719] (2 families) |
Family e.11.1.1: Type II DNA topoisomerase C-terminal domain-like [56720] (3 proteins) domain 2 contains the catalytic tyrosine residue |
Protein automated matches [191158] (6 species) not a true protein |
Species Vibrio fischeri [TaxId:312309] [226391] (2 PDB entries) |
Domain d3kuab1: 3kua B:363-492 [305734] Other proteins in same PDB: d3kuaa2, d3kuab2, d3kuac_, d3kuad_ automated match to d4elza_ complexed with gol |
PDB Entry: 3kua (more details), 2.13 Å
SCOPe Domain Sequences for d3kuab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kuab1 e.11.1.1 (B:363-492) automated matches {Vibrio fischeri [TaxId: 312309]} trrtifelrkardrahileglalalanideiieliknaptpaeakeglisrgwdlgnvas mleragtdaarpdwlepefgiregkyflteqqaqailelrlhrltglehekildeykall deiaelmhil
Timeline for d3kuab1:
View in 3D Domains from other chains: (mouse over for more information) d3kuaa1, d3kuaa2, d3kuac_, d3kuad_ |