SCOPe 2.08: Domain d3kuaa1: 3kua A:363-494

Lineage for d3kuaa1 (3kua A:363-494)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.11: Type II DNA topoisomerase C-terminal domain-like [56718] (1 superfamily)
   4 domains: (1) toprim alpha/beta; (2) "winged helix"-like; (3) alpha+beta; (4) all-alpha

4. Superfamily e.11.1: Type II DNA topoisomerase C-terminal domain-like [56719] (2 families)

5. Family e.11.1.1: Type II DNA topoisomerase C-terminal domain-like [56720] (3 proteins)
   domain 2 contains the catalytic tyrosine residue

6. Protein automated matches [191158] (6 species)
   not a true protein

7. Species Vibrio fischeri [TaxId:312309] [226391] (2 PDB entries)

8. Domain d3kuaa1: 3kua A:363-494 [305732]
   Other proteins in same PDB: d3kuaa2, d3kuab2, d3kuac_, d3kuad_
   automated match to d4elza_
   complexed with gol

Details for d3kuaa1

PDB Entry: 3kua, 2.13 Å

PDB Description: CcdBVfi:GyrA14Vfi

PDB Compounds: (A:) DNA gyrase (Type II topoisomerase), subunit A

SCOPe Domain Sequences for d3kuaa1:

Sequence; same for both SEQRES and ATOM records:

>d3kuaa1 e.11.1.1 (A:363-494) automated matches {Vibrio fischeri [TaxId: 312309]}
trrtifelrkardrahileglalalanideiieliknaptpaeakeglisrgwdlgnvas
mleragtdaarpdwlepefgiregkyflteqqaqailelrlhrltglehekildeykall
deiaelmhilas

Timeline for d3kuaa1:

• d3kuaa1 first appeared in SCOPe 2.06
  
• d3kuaa1 appears in SCOPe 2.07