Lineage for d3ku8c_ (3ku8 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784275Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2784276Family b.34.6.1: CcdB [50119] (1 protein)
    automatically mapped to Pfam PF01845
  6. 2784277Protein CcdB [50120] (2 species)
    topoisomerase poison
  7. 2784299Species Vibrio fischeri [TaxId:668] [189154] (7 PDB entries)
  8. 2784302Domain d3ku8c_: 3ku8 C: [305730]
    Other proteins in same PDB: d3ku8a_, d3ku8b_
    automated match to d4elzc_
    complexed with cl, so4

Details for d3ku8c_

PDB Entry: 3ku8 (more details), 1.93 Å

PDB Description: CcdBVfi:GyrA14Ec
PDB Compounds: (C:) ccdb

SCOPe Domain Sequences for d3ku8c_:

Sequence, based on SEQRES records: (download)

>d3ku8c_ b.34.6.1 (C:) CcdB {Vibrio fischeri [TaxId: 668]}
sqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpielldkkapshlcptihid
egdfimltqqmtsvpvkilsepvnelstfrneiiaaidflitgi

Sequence, based on observed residues (ATOM records): (download)

>d3ku8c_ b.34.6.1 (C:) CcdB {Vibrio fischeri [TaxId: 668]}
sqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpiepshlcptihidegdfim
ltqqmtsvpvkilsepvnelstfrneiiaaidflitgi

SCOPe Domain Coordinates for d3ku8c_:

Click to download the PDB-style file with coordinates for d3ku8c_.
(The format of our PDB-style files is described here.)

Timeline for d3ku8c_: