SCOPe 2.08: Domain d3ku8b_: 3ku8 B:

Lineage for d3ku8b_ (3ku8 B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.11: Type II DNA topoisomerase C-terminal domain-like [56718] (1 superfamily)
   4 domains: (1) toprim alpha/beta; (2) "winged helix"-like; (3) alpha+beta; (4) all-alpha

4. Superfamily e.11.1: Type II DNA topoisomerase C-terminal domain-like [56719] (2 families)

5. Family e.11.1.1: Type II DNA topoisomerase C-terminal domain-like [56720] (3 proteins)
   domain 2 contains the catalytic tyrosine residue

6. Protein automated matches [191158] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [311306] (1 PDB entry)

8. Domain d3ku8b_: 3ku8 B: [305729]
   Other proteins in same PDB: d3ku8c_, d3ku8d_
   automated match to d4elza_
   complexed with cl, so4

Details for d3ku8b_

PDB Entry: 3ku8, 1.93 Å

PDB Description: CcdBVfi:GyrA14Ec

PDB Compounds: (B:) DNA gyrase subunit A

SCOPe Domain Sequences for d3ku8b_:

Sequence; same for both SEQRES and ATOM records:

>d3ku8b_ e.11.1.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
trrtifelrkardrahilealavalanidpiielirhaptpaeaktalvanpwqlgnvaa
mleragddaarpewlepefgvrdglyylteqqaqaildlrlqkltgleheklldeykell
dqiaellrilgsadr

Timeline for d3ku8b_:

• d3ku8b_ first appeared in SCOPe 2.06
  
• d3ku8b_ appears in SCOPe 2.07