![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.11: Type II DNA topoisomerase C-terminal domain-like [56718] (1 superfamily) 4 domains: (1) toprim alpha/beta; (2) "winged helix"-like; (3) alpha+beta; (4) all-alpha |
![]() | Superfamily e.11.1: Type II DNA topoisomerase C-terminal domain-like [56719] (2 families) ![]() |
![]() | Family e.11.1.1: Type II DNA topoisomerase C-terminal domain-like [56720] (3 proteins) domain 2 contains the catalytic tyrosine residue |
![]() | Protein automated matches [191158] (6 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [311306] (1 PDB entry) |
![]() | Domain d3ku8a_: 3ku8 A: [305728] Other proteins in same PDB: d3ku8c_, d3ku8d_ automated match to d4elza_ complexed with cl, so4 |
PDB Entry: 3ku8 (more details), 1.93 Å
SCOPe Domain Sequences for d3ku8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ku8a_ e.11.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]} trrtifelrkardrahilealavalanidpiielirhaptpaeaktalvanpwqlgnvaa mleragddaarpewlepefgvrdglyylteqqaqaildlrlqkltgleheklldeykell dqiaellrilgsadr
Timeline for d3ku8a_: