Lineage for d1lpfb2 (1lpf B:159-277)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109341Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2109342Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2109874Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2109893Protein Dihydrolipoamide dehydrogenase [51959] (8 species)
  7. 2109930Species Pseudomonas fluorescens [TaxId:294] [51961] (1 PDB entry)
  8. 2109934Domain d1lpfb2: 1lpf B:159-277 [30572]
    Other proteins in same PDB: d1lpfa3, d1lpfb3
    complexed with fad

Details for d1lpfb2

PDB Entry: 1lpf (more details), 2.8 Å

PDB Description: three-dimensional structure of lipoamide dehydrogenase from pseudomonas fluorescens at 2.8 angstroms resolution. analysis of redox and thermostability properties
PDB Compounds: (B:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1lpfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpfb2 c.3.1.5 (B:159-277) Dihydrolipoamide dehydrogenase {Pseudomonas fluorescens [TaxId: 294]}
paplsddiivdstgalefqavpkklgvigagviglelgsvwarlgaevtvlealdkflpa
adeqiakealkvltkqglnirlgarvtasevkkkqvtvtftdangeqketfdklivavg

SCOPe Domain Coordinates for d1lpfb2:

Click to download the PDB-style file with coordinates for d1lpfb2.
(The format of our PDB-style files is described here.)

Timeline for d1lpfb2: