Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein Dihydrolipoamide dehydrogenase [51959] (8 species) |
Species Pseudomonas fluorescens [TaxId:294] [51961] (1 PDB entry) |
Domain d1lpfb2: 1lpf B:159-277 [30572] Other proteins in same PDB: d1lpfa3, d1lpfb3 complexed with fad |
PDB Entry: 1lpf (more details), 2.8 Å
SCOPe Domain Sequences for d1lpfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lpfb2 c.3.1.5 (B:159-277) Dihydrolipoamide dehydrogenase {Pseudomonas fluorescens [TaxId: 294]} paplsddiivdstgalefqavpkklgvigagviglelgsvwarlgaevtvlealdkflpa adeqiakealkvltkqglnirlgarvtasevkkkqvtvtftdangeqketfdklivavg
Timeline for d1lpfb2: