SCOPe 2.07: Domain d3kptb2: 3kpt B:409-515

Lineage for d3kptb2 (3kpt B:409-515)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.5: Cna protein B-type domain [49478] (2 families)

5. Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins)
   Pfam PF05738

6. Protein Gram-positive bacterial pilin domains [310720] (2 species)

7. Species Bacillus cereus ATCC 14579 [TaxId:226900] [310967] (1 PDB entry)

8. Domain d3kptb2: 3kpt B:409-515 [305719]
   Other proteins in same PDB: d3kpta3, d3kptb3, d3kptb4
   complexed with ca

Details for d3kptb2

PDB Entry: 3kpt, 2.1 Å

PDB Description: crystal structure of bcpa, the major pilin subunit of bacillus cereus

PDB Compounds: (B:) Collagen adhesion protein

SCOPe Domain Sequences for d3kptb2:

Sequence; same for both SEQRES and ATOM records:

>d3kptb2 b.3.5.1 (B:409-515) Gram-positive bacterial pilin domains {Bacillus cereus ATCC 14579 [TaxId: 226900]}
ttgiieltkidsanknkmkgaefvlkdnngkivvvagkevtgvsdengvikwsnipygdy
qifetkaptytkedgtktsyqllkdpidvkisennqtvkltiennks

Timeline for d3kptb2:

• d3kptb2 first appeared in SCOPe 2.06
  
• d3kptb2 appears in the current release, SCOPe 2.08