Lineage for d3kptb2 (3kpt B:409-515)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2042542Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) (S)
  5. 2042543Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins)
    Pfam PF05738
  6. 2042554Protein Gram-positive bacterial pilin domains [310720] (2 species)
  7. 2042555Species Bacillus cereus ATCC 14579 [TaxId:226900] [310967] (1 PDB entry)
  8. 2042559Domain d3kptb2: 3kpt B:409-515 [305719]
    Other proteins in same PDB: d3kpta3, d3kptb3, d3kptb4
    complexed with ca

Details for d3kptb2

PDB Entry: 3kpt (more details), 2.1 Å

PDB Description: crystal structure of bcpa, the major pilin subunit of bacillus cereus
PDB Compounds: (B:) Collagen adhesion protein

SCOPe Domain Sequences for d3kptb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kptb2 b.3.5.1 (B:409-515) Gram-positive bacterial pilin domains {Bacillus cereus ATCC 14579 [TaxId: 226900]}
ttgiieltkidsanknkmkgaefvlkdnngkivvvagkevtgvsdengvikwsnipygdy
qifetkaptytkedgtktsyqllkdpidvkisennqtvkltiennks

SCOPe Domain Coordinates for d3kptb2:

Click to download the PDB-style file with coordinates for d3kptb2.
(The format of our PDB-style files is described here.)

Timeline for d3kptb2: