Lineage for d3kpta1 (3kpt A:166-267)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2379615Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) (S)
  5. 2379616Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins)
    Pfam PF05738
  6. 2379627Protein Gram-positive bacterial pilin domains [310720] (2 species)
  7. 2379628Species Bacillus cereus ATCC 14579 [TaxId:226900] [310967] (1 PDB entry)
  8. 2379629Domain d3kpta1: 3kpt A:166-267 [305715]
    Other proteins in same PDB: d3kpta3, d3kptb3, d3kptb4
    complexed with ca

Details for d3kpta1

PDB Entry: 3kpt (more details), 2.1 Å

PDB Description: crystal structure of bcpa, the major pilin subunit of bacillus cereus
PDB Compounds: (A:) Collagen adhesion protein

SCOPe Domain Sequences for d3kpta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kpta1 b.3.5.1 (A:166-267) Gram-positive bacterial pilin domains {Bacillus cereus ATCC 14579 [TaxId: 226900]}
krgavdliktgvnekamagavfslfkkdgtevkkelatdanghirvqgleygeyyfqetk
apkgyvidptkreffvknsgtinedgtitsgtvvkmevknne

SCOPe Domain Coordinates for d3kpta1:

Click to download the PDB-style file with coordinates for d3kpta1.
(The format of our PDB-style files is described here.)

Timeline for d3kpta1: