Class b: All beta proteins [48724] (177 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) |
Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins) Pfam PF05738 |
Protein Gram-positive bacterial pilin domains [310720] (2 species) |
Species Bacillus cereus ATCC 14579 [TaxId:226900] [310967] (1 PDB entry) |
Domain d3kpta1: 3kpt A:166-267 [305715] Other proteins in same PDB: d3kpta3, d3kptb3, d3kptb4 complexed with ca |
PDB Entry: 3kpt (more details), 2.1 Å
SCOPe Domain Sequences for d3kpta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kpta1 b.3.5.1 (A:166-267) Gram-positive bacterial pilin domains {Bacillus cereus ATCC 14579 [TaxId: 226900]} krgavdliktgvnekamagavfslfkkdgtevkkelatdanghirvqgleygeyyfqetk apkgyvidptkreffvknsgtinedgtitsgtvvkmevknne
Timeline for d3kpta1:
View in 3D Domains from other chains: (mouse over for more information) d3kptb1, d3kptb2, d3kptb3, d3kptb4 |