Lineage for d1lpfb1 (1lpf B:1-158,B:278-348)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 20953Protein Dihydrolipoamide dehydrogenase [51959] (6 species)
  7. 20978Species Pseudomonas fluorescens [TaxId:294] [51961] (1 PDB entry)
  8. 20981Domain d1lpfb1: 1lpf B:1-158,B:278-348 [30571]
    Other proteins in same PDB: d1lpfa3, d1lpfb3

Details for d1lpfb1

PDB Entry: 1lpf (more details), 2.8 Å

PDB Description: three-dimensional structure of lipoamide dehydrogenase from pseudomonas fluorescens at 2.8 angstroms resolution. analysis of redox and thermostability properties

SCOP Domain Sequences for d1lpfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpfb1 c.3.1.5 (B:1-158,B:278-348) Dihydrolipoamide dehydrogenase {Pseudomonas fluorescens}
sqkfdvvvigagpggyvaairaaqlglktaciekyigkegkvalggtclnvgcipskall
dssykyheakeafkvhgieakgvtidvpamvarkanivknltggiatlfkangvtsfegh
gkllankqvevtgldgktqvleaenviiasgsrpveipXrrpvttdllaadsgvtlderg
fiyvddhcktsvpgvfaigdvvrgamlahkaseegvmvaeriaghkaqmn

SCOP Domain Coordinates for d1lpfb1:

Click to download the PDB-style file with coordinates for d1lpfb1.
(The format of our PDB-style files is described here.)

Timeline for d1lpfb1: