SCOPe 2.08: Domain d1lpfb1: 1lpf B:1-158,B:278-348

Lineage for d1lpfb1 (1lpf B:1-158,B:278-348)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Dihydrolipoamide dehydrogenase, N- and C-terminal domain [418938] (8 species)

7. Species Pseudomonas fluorescens [TaxId:294] [419388] (1 PDB entry)

8. Domain d1lpfb1: 1lpf B:1-158,B:278-348 [30571]
   Other proteins in same PDB: d1lpfa2, d1lpfa3, d1lpfb2, d1lpfb3
   complexed with fad
   has additional insertions and/or extensions that are not grouped together

Details for d1lpfb1

PDB Entry: 1lpf, 2.8 Å

PDB Description: three-dimensional structure of lipoamide dehydrogenase from pseudomonas fluorescens at 2.8 angstroms resolution. analysis of redox and thermostability properties

PDB Compounds: (B:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1lpfb1:

Sequence; same for both SEQRES and ATOM records:

>d1lpfb1 c.3.1.5 (B:1-158,B:278-348) Dihydrolipoamide dehydrogenase, N- and C-terminal domain {Pseudomonas fluorescens [TaxId: 294]}
sqkfdvvvigagpggyvaairaaqlglktaciekyigkegkvalggtclnvgcipskall
dssykyheakeafkvhgieakgvtidvpamvarkanivknltggiatlfkangvtsfegh
gkllankqvevtgldgktqvleaenviiasgsrpveipXrrpvttdllaadsgvtlderg
fiyvddhcktsvpgvfaigdvvrgamlahkaseegvmvaeriaghkaqmn

Timeline for d1lpfb1:

• d1lpfb1 first appeared (with stable ids) in SCOP 1.55
  
• d1lpfb1 appears in SCOPe 2.07