Lineage for d1lpfa2 (1lpf A:159-277)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176176Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 176177Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 176396Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (11 proteins)
  6. 176413Protein Dihydrolipoamide dehydrogenase [51959] (7 species)
  7. 176443Species Pseudomonas fluorescens [TaxId:294] [51961] (1 PDB entry)
  8. 176445Domain d1lpfa2: 1lpf A:159-277 [30570]
    Other proteins in same PDB: d1lpfa3, d1lpfb3

Details for d1lpfa2

PDB Entry: 1lpf (more details), 2.8 Å

PDB Description: three-dimensional structure of lipoamide dehydrogenase from pseudomonas fluorescens at 2.8 angstroms resolution. analysis of redox and thermostability properties

SCOP Domain Sequences for d1lpfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpfa2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Pseudomonas fluorescens}
paplsddiivdstgalefqavpkklgvigagviglelgsvwarlgaevtvlealdkflpa
adeqiakealkvltkqglnirlgarvtasevkkkqvtvtftdangeqketfdklivavg

SCOP Domain Coordinates for d1lpfa2:

Click to download the PDB-style file with coordinates for d1lpfa2.
(The format of our PDB-style files is described here.)

Timeline for d1lpfa2: