Lineage for d3kgma_ (3kgm A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244418Protein beta-Lactamase, class A [56606] (16 species)
  7. 2244419Species Bacillus licheniformis [TaxId:1402] [56612] (14 PDB entries)
  8. 2244442Domain d3kgma_: 3kgm A: [305696]
    automated match to d3ly3a_
    complexed with bb0

Details for d3kgma_

PDB Entry: 3kgm (more details), 2.5 Å

PDB Description: Crystal Structure of fluorophore-labeled Class A Beta-lactamase PenP-E166Cb
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3kgma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kgma_ e.3.1.1 (A:) beta-Lactamase, class A {Bacillus licheniformis [TaxId: 1402]}
kddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedln
qritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkel
rkigdevtnperfcpelnevnpgetqdtstaralvtslrafaledklpsekrellidwmk
rnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdaky
ddkliaeatkvvmkaln

SCOPe Domain Coordinates for d3kgma_:

Click to download the PDB-style file with coordinates for d3kgma_.
(The format of our PDB-style files is described here.)

Timeline for d3kgma_: