SCOPe 2.08: Domain d3kb9a_: 3kb9 A:

Lineage for d3kb9a_ (3kb9 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (46 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [311304] (2 PDB entries)

8. Domain d3kb9a_: 3kb9 A: [305690]
   automated match to d5dz2a_
   complexed with btm, gol, mg, pop, so4

Details for d3kb9a_

PDB Entry: 3kb9, 1.6 Å

PDB Description: Epi-isozizaene synthase: Complex with Mg, inorganic pyrophosphate and benzyl triethyl ammonium cation

PDB Compounds: (A:) Epi-isozizaene synthase

SCOPe Domain Sequences for d3kb9a_:

Sequence; same for both SEQRES and ATOM records:

>d3kb9a_ a.128.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
avppslrlpvieaafprqlhpywpklqettrtwllekrlmpadkveeyadglcytdlmag
yylgapdevlqaiadysawffvwddrhdrdivhgragawrrlrgllhtaldspgdhlhhe
dtlvagfadsvrrlyaflpatwnarfarhfhtvieaydrefhnrtrgivpgveeylelrr
ltfahwiwtdllepssgcelpdavrkhpayrraallsqefaawyndlcslpkeiagdevh
nlgislithhsltleeaigevrrrveeciteflaverdalrfadeladgtvrgkelsgav
ranvgnmrnwfssvywfhhesgrymvdswddrstppyvnn

Timeline for d3kb9a_:

• d3kb9a_ first appeared in SCOPe 2.06
  
• d3kb9a_ appears in SCOPe 2.07