Lineage for d3kaxa_ (3kax A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2148503Species Bacillus anthracis [TaxId:261594] [189194] (4 PDB entries)
  8. 2148504Domain d3kaxa_: 3kax A: [305688]
    automated match to d4dgta_
    complexed with na, peg, plp

Details for d3kaxa_

PDB Entry: 3kax (more details), 1.7 Å

PDB Description: Crystal structure of a putative C-S lyase from Bacillus anthracis
PDB Compounds: (A:) Aminotransferase, classes I and II

SCOPe Domain Sequences for d3kaxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kaxa_ c.67.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}
dtykneelihawiadmdfevpqpiqtalkkriehpifgytlppenigdiicnwtkkqynw
diqkewivfsagivpalstsiqaftkenesvlvqppiyppffemvttnnrqlcvsplqkq
ndtyaidfehlekqfqqgvklmllcsphnpigrvwkkeeltklgslctkynvivvadeih
sdiiyadhthtpfaslseelaartitcmapsktfniaglqasiiiipneklrqaftsiqy
rqgfhglnifaytamqsaytecndwlneirfyiednakfaceyikdhiptlsvmkpegsf
llwidcsalnlsqdertklleekgkiivepgekyglggeehiginigcprsvleeilnrl
rhtfs

SCOPe Domain Coordinates for d3kaxa_:

Click to download the PDB-style file with coordinates for d3kaxa_.
(The format of our PDB-style files is described here.)

Timeline for d3kaxa_: